#########################################################################
# MacSyLib - Python library to detect macromolecular systems #
# in prokaryotes protein dataset using systems modelling #
# and similarity search. #
# #
# Authors: Sophie Abby, Bertrand Neron #
# Copyright (c) 2014-2025 Institut Pasteur (Paris) and CNRS. #
# See the COPYRIGHT file for details #
# #
# This file is part of MacSyLib package. #
# #
# MacSyLib is free software: you can redistribute it and/or modify #
# it under the terms of the GNU General Public License as published by #
# the Free Software Foundation, either version 3 of the License, or #
# (at your option) any later version. #
# #
# MacSyLib is distributed in the hope that it will be useful, #
# but WITHOUT ANY WARRANTY; without even the implied warranty of #
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the #
# GNU General Public License for more details . #
# #
# You should have received a copy of the GNU General Public License #
# along with MacSyLib (COPYING). #
# If not, see <https://www.gnu.org/licenses/>. #
#########################################################################
"""
Module to handle sequences and their indexes
"""
from itertools import groupby
from collections import namedtuple
import os.path
import logging
from .error import MacsylibError, EmptyFileError
from .utils import open_compressed
from typing import TextIO, Iterator, Literal, TypeAlias, Any
from .config import Config
_log = logging.getLogger(__name__)
Topology: TypeAlias = Literal['linear', 'ciircular']
[docs]
def fasta_iter(fasta_file: TextIO) -> Iterator[tuple[str, str, int]]:
"""
:param fasta_file: the file containing all input sequences in fasta format.
:author: http://biostar.stackexchange.com/users/36/brentp
:return: for a given fasta file, it returns an iterator which yields tuples
(string id, string comment, int sequence length)
"""
# ditch the boolean (x[0]) and just keep the header or sequence since
# we know they alternate.
faiter = (x[1] for x in groupby(fasta_file, lambda line: line[0] == ">"))
for header in faiter:
# drop the ">"
header = next(header)[1:].strip()
header = header.split()
_id = header[0]
comment = ' '.join(header[1:])
try:
seq = ''.join(s.strip() for s in next(faiter))
except StopIteration:
# the sequence was not start by '>'
# bad fasta format
msg = f"Error during sequence '{fasta_file.name}' parsing: Check the fasta format."
_log.critical(msg)
raise MacsylibError(msg)
length = len(seq)
yield _id, comment, length
[docs]
class Indexes:
"""
Handle the indexes for macsylib:
- find the indexes required by macsylib to compute some scores, or build them.
"""
_field_separator = "^^"
[docs]
def __init__(self, cfg: Config) -> None:
"""
The constructor retrieves the file of indexes in the case they are not present
or the user asked for build indexes (--idx)
Launch the indexes building.
:param cfg: the configuration
:type cfg: :class:`macsylib.config.Config` object
"""
self.cfg = cfg
self._fasta_path = cfg.sequence_db()
self.name = os.path.basename(self._fasta_path)
[docs]
def build(self, force: bool = False) -> str:
"""
Build the indexes from the sequence data set in fasta format,
:param force: If True, force the index building even
if the index files are present in the sequence data set folder
:return: the path to the index
"""
my_indexes = self.find_my_indexes() # check read
###########################
# build indexes if needed #
###########################
if my_indexes and not force:
with open(my_indexes) as idx:
seq_path = next(idx).strip()
try:
first_item = next(idx).strip()
except StopIteration:
# there is only one line in file
first_item = None
if seq_path.count(';') == 2:
# there is no path in idx, it's an old index
_log.warning(f"The '{my_indexes}' index file is in old format. Force index building.")
force = True
elif seq_path != self._fasta_path:
_log.warning(f"The '{my_indexes}' index file does not point to '{self._fasta_path}'. Force building")
force = True
if not force and first_item:
# the first line of idx is a valid path
if first_item.count(self._field_separator) == 0:
# the separator is different than the actual separator
_log.warning(f"The '{my_indexes}' index file is in old format. Force index building.")
force = True
# if fasta file is newer than idx
stamp_fasta = os.path.getmtime(self._fasta_path)
stamp_idx = os.path.getmtime(my_indexes)
if stamp_idx < stamp_fasta:
_log.debug("the sequence index is older than sequence file: rebuild the index.")
force = True
if force or not my_indexes:
try:
index_dir = self._index_dir(build=True) # check build
except ValueError as err:
msg = str(err)
_log.critical(msg)
raise IOError(msg) from None
my_indexes = self._build_my_indexes(index_dir)
return my_indexes
[docs]
def find_my_indexes(self) -> str | None:
"""
:return: the file of macsylib indexes if it exists in the dataset folder, None otherwise.
:rtype: string
"""
index_dir = self._index_dir(build=False)
path = os.path.join(index_dir, self.name + ".idx")
if os.path.exists(path):
return path
[docs]
def _index_dir(self, build: bool = False) -> str:
"""
search where to store(build=True) read indexes
:param build: if check the index-dir permissions to write
:return: The directory where read or write the indexes
:raise ValueError: if the directory specify by --index-dir option does not exist
or if build = True index-dir is not writable
"""
index_dir = self.cfg.index_dir()
if index_dir:
if not os.path.exists(index_dir):
raise ValueError(f"No such directory: {index_dir}")
elif build and not os.access(index_dir, os.W_OK):
raise ValueError(f"The '{index_dir}' dir is not writable.")
else:
return index_dir
else:
# we need abspath because if user provide filename not path for sequence_db
# for instance my_seq.faste instead of ./my_seq.fasta
# then index_dir is empty string
# and os.access return False
index_dir = os.path.dirname(os.path.abspath(self.cfg.sequence_db()))
if build and not os.access(index_dir, os.W_OK):
raise ValueError(f"The '{index_dir}' dir is not writable. Change rights or specify --index-dir.")
else:
return index_dir
[docs]
def _build_my_indexes(self, index_dir: str) -> str:
"""
Build macsylib indexes. These indexes are stored in a file.
The file format is the following:
- the first line is the path of the sequence-db indexed
- one entry per line, with each line having this format:
- sequence id;sequence length;sequence rank
"""
index_file = os.path.join(index_dir, self.name + ".idx")
try:
with open_compressed(self._fasta_path, 'rt') as fasta_file:
with open(index_file, 'w') as my_base:
my_base.write(self._fasta_path + '\n')
f_iter = fasta_iter(fasta_file)
seq_nb = 0
for seq_id, comment, length in f_iter:
seq_nb += 1
my_base.write(f"{seq_id}{self._field_separator}{length:d}{self._field_separator}{seq_nb:d}\n")
my_base.flush()
except ValueError as err:
msg = f"Cannot index '{self._fasta_path}': {err}"
_log.critical(msg)
raise MacsylibError(msg)
except Exception as err:
msg = f"unable to index the sequence dataset: {self.cfg.sequence_db()} : {err}"
_log.critical(msg, exc_info=True)
raise MacsylibError(msg) from err
if seq_nb == 0:
os.unlink(index_file)
msg = f"The sequence-db file '{self._fasta_path}' does not contains sequences."
raise EmptyFileError(msg)
return index_file
[docs]
def __iter__(self) -> Iterator[tuple[str, str, int]]:
"""
:raise MacsylibError: if the indexes are not buid
:return: an iterator on the indexes
To use it the index must be built.
"""
path = self.find_my_indexes()
if path is None:
raise MacsylibError("Build index before to use it.")
with open(path) as idx_file:
# The first line of index is the path to the data
# It is not an index
_ = next(idx_file)
for line in idx_file:
try:
seq_id, length, _rank = line.split(self._field_separator)
except Exception as err:
raise MacsylibError(f"fail to parse database index {path} at line: {line}."
f"Try to rebuild index with --idx option or remove file."
f"If error persist feel free to submit an issue at"
f"https://github.com/gem-pasteur/macsylib/issues/new?assignees=&labels=bug&template=bug_report.md&title=%5BBUG%5D ", err) from err
length = int(length)
_rank = int(_rank)
yield seq_id, length, _rank
RepliconInfo = namedtuple('RepliconInfo', ('topology', 'min', 'max', 'genes'))
"""
handle information about a replicon
.. py:attribute:: topology
:noindex:
The type of replicon topology 'linear or 'circular'
.. py:attribute:: min
:noindex:
The position of the last gene of the replicon in the sequence dataset.
.. py:attribute:: max
:noindex:
The position of the last gene of the replicon in the sequence dataset.
.. py:attribute:: genes
:noindex:
A list of genes beloging to the replicon. Each genes is representing by a tuple (str seq_id, int length)
"""
[docs]
class RepliconDB:
"""
Stores information (topology, min, max, [genes]) for all replicons in the sequence_db
the Replicon object must be instantiated only for sequence_db of type 'gembase' or 'ordered_replicon'
"""
[docs]
def __init__(self, cfg: Config) -> None:
"""
:param cfg: The configuration object
:type cfg: :class:`macsylib.config.Config` object
.. note ::
This class can be instanced only if the db_type is 'gembase' or 'ordered_replicon'
"""
self.cfg = cfg
assert self.cfg.db_type() in ('gembase', 'ordered_replicon')
self._idx = Indexes(self.cfg)
self.topology_file = self.cfg.topology_file()
self._DB = {}
if self.topology_file:
topo_dict = self._fill_topology()
else:
topo_dict = {}
if self.cfg.db_type() == 'gembase':
self._fill_gembase_min_max(topo_dict, default_topology=self.cfg.replicon_topology())
else:
self._ordered_replicon_name = os.path.splitext(os.path.basename(self.cfg.sequence_db()))[0]
self._fill_ordered_min_max(self.cfg.replicon_topology())
@property
def ordered_replicon_name(self) -> str:
return self._ordered_replicon_name
[docs]
def guess_if_really_gembase(self) -> bool:
"""
Count the number of replicon with only on sequence
if this number is above a threshold may be it's not gembase. for instance the folowing sequence
have id compliant with the gembase id syntax but it's not it only contains one replicon ('ordered replicon')
| >1E10S0A0cP00_0010 D GTG TGA 483 2027 Valid dnaA 1545 _PA0001_NP_064721.1_ PA0001 1 483 2027
| MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNRFVLDW
| >0200S001A0c_0P1E0 D ATG TAA 2056 3159 Valid dnaN 1104 _PA0002_NP_064722.1_ PA0002 1 2056 3159
| MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLE
| >0000310E00S0c_1PA D ATG TGA 3169 4278 Valid recF 1110 _PA0003_NP_064723.1_ PA0003 1 3169 4278
| MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLAR
| >c_01000A0PS00014E D ATG TGA 4275 6695 Valid gyrB 2421 _PA0004_NP_064724.1_ PA0004 1 4275 6695
| MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSI
| >07700ES100A0cP01_ C ATG TGA 91521 94826 Valid icmF1 3306 _PA0077_NP_248767.1_ PA0077 1 91521 94826
| MQSLAEVSAPDAASVAT
:return: False if most replicon contains only one sequence, True otherwise
"""
all_len = [rep.max - rep.min for rep in self._DB.values()]
replicon_with_one_seq = all_len.count(0)
if replicon_with_one_seq > len(all_len) * 0.8:
return False
else:
return True
[docs]
def _fill_topology(self) -> dict[str: str]:
"""
Fill the internal dictionary with min and max positions for each replicon_name of the sequence_db
"""
topo_dict = {}
with open(self.topology_file) as topo_f:
for line in topo_f:
if line.startswith('#'):
continue
replicon_name, topo = line.split(':')
replicon_name = replicon_name.strip()
topo = topo.strip().lower()
topo_dict[replicon_name] = topo
return topo_dict
[docs]
def _fill_ordered_min_max(self, default_topology: Topology | None = None) -> None:
"""
For the replicon_name of the ordered_replicon sequence base, fill the internal dict with RepliconInfo
:param default_topology: the topology provided by config.replicon_topology
:type default_topology: string
"""
_min = 1
_max = 0
genes = []
for seq_id, length, _rank in self._idx:
genes.append((seq_id, length))
_max += 1
self._DB[self.ordered_replicon_name] = RepliconInfo(default_topology, _min, _max, genes)
[docs]
def _fill_gembase_min_max(self, topology: dict[str: Topology], default_topology: Topology) -> None:
"""
For each replicon_name of a gembase dataset, it fills the internal dictionary with a namedtuple RepliconInfo
:param topology: the topologies for each replicon
(parsed from the file specified with the option --topology-file)
:param default_topology: the topology provided by the config.replicon_topology
"""
def grp_replicon(entry: str) -> str:
"""
in gembase the identifier of fasta sequence follows the following schema:
<replicon-name>_<seq-name> with eventually '_' inside the <replicon_name>
but not in the <seq-name>.
for draft genome the seqname is postfix with 'b' if the sequence is border of the contig
or 'i' if it is inside.
so grp_replicon allow to group sequences belonging to the same replicon.
"""
return "_".join(entry[0].split('_')[: -1]).rstrip('ib')
def parse_seq_id(seq_id):
"""
parse a gembase sequence id (.idx)
seq_id has the following format <replicon-name>_<seq-name> with eventually '_' inside the <replicon_name>
but not in the <seq-name>.
"""
*replicon_name, seq_name = seq_id.split('_')
replicon_name = "_".join(replicon_name)
return replicon_name, seq_name
replicons = (x[1] for x in groupby(self._idx, grp_replicon))
for replicon in replicons:
genes = []
seq_id, seq_length, _min = next(replicon)
replicon_name, seq_name = parse_seq_id(seq_id)
genes.append((seq_name, seq_length))
for seq_id, seq_length, rank in replicon:
# pass all sequence of the replicon until the last one
_, seq_name = parse_seq_id(seq_id)
genes.append((seq_name, seq_length))
_, seq_name = parse_seq_id(seq_id)
try:
_max = rank
except UnboundLocalError:
# there is only one sequence for this replicon
_max = _min
genes.append((seq_name, seq_length))
if replicon_name in topology:
self._DB[replicon_name] = RepliconInfo(topology[replicon_name], _min, _max, genes)
else:
self._DB[replicon_name] = RepliconInfo(default_topology, _min, _max, genes)
[docs]
def __contains__(self, replicon_name: str) -> bool:
"""
:param replicon_name: the name of the replicon
:returns: True if replicon_name is in the repliconDB, false otherwise.
"""
return replicon_name in self._DB
[docs]
def __getitem__(self, replicon_name: str) -> RepliconInfo:
"""
:param replicon_name: the name of the replicon to get information on
:returns: the RepliconInfo for the provided replicon_name
:raise: KeyError if replicon_name is not in repliconDB
"""
return self._DB[replicon_name]
[docs]
def get(self, replicon_name: str, default: Any = None) -> RepliconInfo:
"""
:param replicon_name: the name of the replicon to get information
:param default: the value to return if the replicon_name is not in the RepliconDB
:returns: the RepliconInfo for replicon_name if replicon_name is in the repliconDB, else default.
If default is not given, it is set to None, so that this method never raises a KeyError.
"""
return self._DB.get(replicon_name, default)
[docs]
def items(self) -> list[tuple[str, RepliconInfo]]:
"""
:return: a copy of the RepliconDB as a list of (replicon_name, RepliconInfo) pairs
"""
return list(self._DB.items())
[docs]
def iteritems(self) -> Iterator[tuple[str, RepliconInfo]]:
"""
:return: an iterator over the RepliconDB as a list (replicon_name, RepliconInfo) pairs
"""
return iter(self._DB.items())
[docs]
def replicon_names(self) -> list[str]:
"""
:return: a copy of the RepliconDB as a list of replicon_names
"""
return list(self._DB.keys())
[docs]
def replicon_infos(self) -> list[RepliconInfo]:
"""
:return: a copy of the RepliconDB as list of replicons info
:rtype: RepliconInfo instance
"""
return list(self._DB.values())