In this chapter we’ll discuss in more detail the Bio.SeqIO module, which was briefly introduced in Chapter 2. This is a relatively new interface, added in Biopython 1.43, which aims to provide a simple interface for working with assorted sequence file formats in a uniform way.
The “catch” is that you have to work with SeqRecord ojects - which contain a Seq object (as described in Chapter 3) plus annotation like an identifier and description. We’ll introduce the basics of SeqRecord object in this chapter, but see Section 10.1 for more details.
The workhorse function Bio.SeqIO.parse() is used to read in sequence data as SeqRecord objects. This function expects two arguments:
This returns an iterator which gives SeqRecord objects. Iterators are typically used in a for loop.
Sometimes you’ll find yourself dealing with files which contain only a single record. For this situation Biopython 1.45 introduced the function Bio.SeqIO.read(). Again, this takes a handle and format as arguments. Provided there is one and only one record, this is returned as a SeqRecord object.
In general Bio.SeqIO.parse() is used to read in sequence files as SeqRecord objects, and is typically used with a for loop like this:
from Bio import SeqIO
handle = open("ls_orchid.fasta")
for seq_record in SeqIO.parse(handle, "fasta") :
print seq_record.id
print repr(seq_record.seq)
print len(seq_record.seq)
handle.close()
The above example is repeated from the introduction in Section 2.4, and will load the orchid DNA sequences in the FASTA format file ls_orchid.fasta. If instead you wanted to load a GenBank format file like ls_orchid.gbk then all you need to do is change the filename and the format string:
from Bio import SeqIO
handle = open("ls_orchid.gbk")
for seq_record in SeqIO.parse(handle, "genbank") :
print seq_record.id
print seq_record.seq
print len(seq_record.seq)
handle.close()
Similarly, if you wanted to read in a file in another file format, then assuming Bio.SeqIO.parse() supports it you would just need to change the format string as appropriate, for example “swiss” for SwissProt files or “embl” for EMBL text files. There is a full listing on the wiki page (http://biopython.org/wiki/SeqIO).
In the above examples, we have usually used a for loop to iterate over all the records one by one. You can use the for loop with all sorts of Python objects (including lists, tuples and strings) which support the iteration interface.
The object returned by Bio.SeqIO is actually an iterator which returns SeqRecord objects. You get to see each record in turn, but once and only once. The plus point is that an iterator can save you memory when dealing with large files.
Instead of using a for loop, can also use the .next() method of an iterator to step through the entries, like this:
from Bio import SeqIO
handle = open("ls_orchid.fasta")
record_iterator = SeqIO.parse(handle, "fasta")
first_record = record_iterator.next()
print first_record.id
print first_record.description
second_record = record_iterator.next()
print second_record.id
print second_record.description
handle.close()
Note that if you try and use .next() and there are no more results, you’ll either get back the special Python object None or a StopIteration exception.
One special case to consider is when your sequence files have multiple records, but you only want the first one. In this situation the following code is very concise:
from Bio import SeqIO
first_record = SeqIO.parse(open("ls_orchid.gbk"), "genbank").next()
A word of warning here – using the .next() method like this will silently ignore any additional records in the file.
If your files have one and only one record, like some of the online examples later in this chapter, or a GenBank file for a single chromosome, then use the new Bio.SeqIO.read() function instead.
This will check there are no extra unexpected records present.
In the previous section we talked about the fact that Bio.SeqIO.parse() gives you a SeqRecord iterator, and that you get the records one by one. Very often you need to be able to access the records in any order. The Python list data type is perfect for this, and we can turn the record iterator into a list of SeqRecord objects using the built-in Python function list() like so:
from Bio import SeqIO
handle = open("ls_orchid.gbk")
records = list(SeqIO.parse(handle, "genbank"))
handle.close()
print "Found %i records" % len(records)
print "The last record"
last_record = records[-1] #using Python's list tricks
print last_record.id
print repr(last_record.seq)
print len(last_record.seq)
print "The first record"
first_record = records[0] #remember, Python counts from zero
print first_record.id
print repr(first_record.seq)
print len(first_record.seq)
Giving:
Found 94 records
The last record
Z78439.1
Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC', IUPACAmbiguousDNA())
592
The first record
Z78533.1
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC', IUPACAmbiguousDNA())
740
You can of course still use a for loop with a list of SeqRecord objects. Using a list is much more flexible than an iterator (for example, you can determine the number of records from the length of the list), but does need more memory because it will hold all the records in memory at once.
Suppose you wanted to extract a list of the species from the ls_orchid.gbk GenBank file. Let’s have a close look at the first record in the file and see where the species gets stored:
from Bio import SeqIO
record_iterator = SeqIO.parse(open("ls_orchid.gbk"), "genbank")
first_record = record_iterator.next()
print first_record
That should give something like this:
ID: Z78533.1
Name: Z78533
Desription: C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA.
/source=Cypripedium irapeanum
/taxonomy=['Eukaryota', 'Viridiplantae', 'Streptophyta', ..., 'Cypripedium']
/keywords=['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal transcribed spacer', 'ITS1', 'ITS2']
/references=[...]
/accessions=['Z78533']
/data_file_division=PLN
/date=30-NOV-2006
/organism=Cypripedium irapeanum
/gi=2765658
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC', IUPACAmbiguousDNA())
The information we want, Cypripedium irapeanum, is held in the annotations dictionary under ‘source’ and ‘organism’, which we can access like this:
print first_record.annotations["source"]
or:
print first_record.annotations["organism"]
In general, ‘organism’ is used for the scientific name (in latin, e.g. Arabidopsis thaliana), while ‘source’ will often be the common name (e.g. thale cress). In this example, as is often the case, the two fields are identical.
Now let’s go through all the records, building up a list of the species each orchid sequence is from:
from Bio import SeqIO
handle = open("ls_orchid.gbk")
all_species = []
for seq_record in SeqIO.parse(handle, "genbank") :
all_species.append(seq_record.annotations["organism"])
handle.close()
print all_species
Another way of writing this code is to use a list comprehension (introduced in Python 2.0) like this:
from Bio import SeqIO
all_species = [seq_record.annotations["organism"] for seq_record in \
SeqIO.parse(open("ls_orchid.gbk"), "genbank")]
print all_species
In either case, the result is:
['Cypripedium irapeanum', 'Cypripedium californicum', ..., 'Paphiopedilum barbatum']
Great. That was pretty easy because GenBank files are annotated in a standardised way. Now, let’s suppose you wanted to extract a list of the species from your FASTA file, rather than the GenBank file. The bad news is you will have to write some code to extract the data you want from the record’s description line - if the information is in the file in the first place!
For this example, notice that if you break up the description line at the spaces, then the species is there as field number one (field zero is the record identifier). That means we can do this:
from Bio import SeqIO
handle = open("ls_orchid.fasta")
all_species = []
for seq_record in SeqIO.parse(handle, "fasta") :
all_species.append(seq_record.description.split()[1])
handle.close()
print all_species
This gives:
['C.irapeanum', 'C.californicum', 'C.fasciculatum', 'C.margaritaceum', ..., 'P.barbatum']
The concise alternative using list comprehensions (Python 2.0 or later) would be:
from Bio import SeqIO
all_species == [seq_record.description.split()[1] for seq_record in \
SeqIO.parse(open("ls_orchid.fasta"), "fasta")]
print all_species
In general, extracting information from the FASTA description line is not very nice. If you can get your sequences in a well annotated file format like GenBank or EMBL, then this sort of annotation information is much easier to deal with.
In the previous section, we looked at parsing sequence data from a file handle. We hinted that handles are not always from files, and in this section we’ll use handles to internet connections to download sequences.
Note that just because you can download sequence data and parse it into
a SeqRecord object in one go doesn’t mean this is always a good idea.
In general, you should probably download sequences once and save them to
a file for reuse.
Section 7.6 talks about the Entrez EFetch interface in more detail, but for now let’s just connect to the NCBI and get a few orchid proteins from GenBank using their GI numbers.
First of all, let’s fetch just one record. Remember, when you expect the handle
to contain one and only one record, use the Bio.SeqIO.read() function:
from Bio import Entrez form Bio import SeqIO handle = Entrez.efetch(db="protein", rettype="genbank", id="6273291") seq_record = SeqIO.read(handle, "genbank") handle.close() print "%s with %i features" % (seq_record.id, len(seq_record.features))
Expected output:
gi|6273291|gb|AF191665.1|AF191665 with 3 features
The NCBI will also let you ask for the file in other formats, for example as a FASTA file. If you don’t care about the annotations and features in a GenBank file, this is a better choice to download because it’s a smaller file:
from Bio import Entrez form Bio import SeqIO handle = Entrez.efetch(db="protein", rettype="fasta", id="6273291") seq_record = SeqIO.read(handle, "fasta") handle.close() print "%s with %i features" % (seq_record.id, len(seq_record.features))
Expected output:
gi|6273291|gb|AF191665.1|AF191665 with 0 features
Now let’s fetch several records. This time the handle contains multiple records,
so we must use the Bio.SeqIO.parse() function:
from Bio import Entrez
form Bio import SeqIO
handle = Entrez.efetch(db="protein", rettype="genbank", \
id="6273291,6273290,6273289")
for seq_record in SeqIO.parse(handle, "genbank") :
print seq_record.id, seq_record.description[:50] + "..."
print "Sequence length %i," % len(seq_record),
print "%i features," % len(seq_record.features),
print "from: %s" % seq_record.annotations['source']
handle.close()
That should give the following output:
AF191665.1 Opuntia marenae rpl16 gene; chloroplast gene for c... Sequence length 902, 3 features, from: chloroplast Opuntia marenae AF191664.1 Opuntia clavata rpl16 gene; chloroplast gene for c... Sequence length 899, 3 features, from: chloroplast Grusonia clavata AF191663.1 Opuntia bradtiana rpl16 gene; chloroplast gene for... Sequence length 899, 3 features, from: chloroplast Opuntia bradtianaa
See Chapter 7 for more about the Bio.Entrez module, and make sure to read about the NCBI guidelines for using Entrez (Section 7.1).
Now let’s use a handle to download a SwissProt file from ExPASy, something covered in more depth in Chapter 8.
As mentioned above, the Bio.SeqIO.read() function is included in Biopython 1.45 or later.
from Bio import ExPASy
from Bio import SeqIO
handle = ExPASy.get_sprot_raw("O23729")
seq_record = SeqIO.read(handle, "swiss")
handle.close()
print seq_record.id
print seq_record.name
print seq_record.description
print repr(seq_record.seq)
print "Length %i" % len(seq_record)
print seq_record.annotations['keywords']
Assuming your network connection is OK, you should get back:
O23729
CHS3_BROFI
Chalcone synthase 3 (EC 2.3.1.74) (Naringenin-chalcone synthase 3).
Seq('MAPAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELK...GAE', ProteinAlphabet())
Length 394
['Acyltransferase', 'Flavonoid biosynthesis', 'Transferase']
The next thing that we’ll do with our ubiquitous orchid files is to show how to index them and access them like a database using the Python dictionary datatype (like a hash in Perl). This is very useful for large files where you only need to access certain elements of the file, and makes for a nice quick ’n dirty database.
You can use the function SeqIO.to_dict() to make a SeqRecord dictionary (in memory). By default this will use each record’s identifier (i.e. the .id attribute) as the key. Let’s try this using our GenBank file:
from Bio import SeqIO
handle = open("ls_orchid.gbk")
orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "genbank"))
handle.close()
Since this variable orchid_dict is an ordinary Python dictionary, we can look at all of the keys we have available:
>>> print orchid_dict.keys() ['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']
We can access a single SeqRecord object via the keys and manipulate the object as normal:
>>> seq_record = orchid_dict["Z78475.1"]
>>> print seq_record.description
P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA
>>> print repr(seq_record.seq)
Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT', IUPACAmbiguousDNA())
So, it is very easy to create an in memory “database” of our GenBank records. Next we’ll try this for the FASTA file instead.
Using the same code as above, but for the FASTA file instead:
from Bio import SeqIO
handle = open("ls_orchid.fasta")
orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "fasta"))
handle.close()
print orchid_dict.keys()
This time the keys are:
['gi|2765596|emb|Z78471.1|PDZ78471', 'gi|2765646|emb|Z78521.1|CCZ78521', ... ..., 'gi|2765613|emb|Z78488.1|PTZ78488', 'gi|2765583|emb|Z78458.1|PHZ78458']
You should recognise these strings from when we parsed the FASTA file earlier in Section 2.4.1. Suppose you would rather have something else as the keys - like the accesion numbers. This brings us nicely to SeqIO.to_dict()’s optional argument key_function, which lets you define what to use as the dictionary key for your records.
First you must write your own function to return the key you want (as a string) when given a SeqRecord object. In general, the details of function will depend on the sort of input records you are dealing with. But for our orchids, we can just split up the record’s identifier using the “pipe” character (the vertical line) and return the fourth entry (field three):
def get_accession(record) :
""""Given a SeqRecord, return the accession number as a string
e.g. "gi|2765613|emb|Z78488.1|PTZ78488" -> "Z78488.1"
"""
parts = record.id.split("|")
assert len(parts) == 5 and parts[0] == "gi" and parts[2] == "emb"
return parts[3]
Then we can give this function to the SeqIO.to_dict() function to use in building the dictionary:
from Bio import SeqIO
handle = open("ls_orchid.fasta")
orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "fasta"), key_function=get_accession)
handle.close()
print orchid_dict.keys()
Finally, as desired, the new dictionary keys:
>>> print orchid_dict.keys() ['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1', 'Z78453.1', ..., 'Z78471.1']
Not too complicated, I hope!
To give another example of working with dictionaries of SeqRecord objects, we’ll use the SEGUID checksum function (added in Biopython 1.44). This is a relatively recent checksum, and collisions should be very rare (i.e. two different sequences with the same checksum), an improvement on the CRC64 checksum.
Once again, working with the orchids GenBank file:
from Bio import SeqIO
from Bio.SeqUtils.CheckSum import seguid
for record in SeqIO.parse(open("ls_orchid.gbk"), "genbank") :
print record.id, seguid(record.seq)
This should give:
Z78533.1 JUEoWn6DPhgZ9nAyowsgtoD9TTo Z78532.1 MN/s0q9zDoCVEEc+k/IFwCNF2pY ... Z78439.1 H+JfaShya/4yyAj7IbMqgNkxdxQ
Now, recall the Bio.SeqIO.to_dict() function’s key_function argument expects a function which turns a SeqRecord into a string. We can’t use the seguid() function directly because it expects to be given a Seq object (or a string). However, we can use python’s lambda feature to create a “one off” function to give to Bio.SeqIO.to_dict() instead:
from Bio import SeqIO
from Bio.SeqUtils.CheckSum import seguid
seguid_dict = SeqIO.to_dict(SeqIO.parse(open("ls_orchid.gbk"), "genbank"),
lambda rec : seguid(rec.seq))
record = seguid_dict["MN/s0q9zDoCVEEc+k/IFwCNF2pY"]
print record.id
print record.description
That should have retrieved the record Z78532.1, the second entry in the file.
We’ve talked about using Bio.SeqIO.parse() for sequence input (reading files), and now we’ll look at Bio.SeqIO.write() which is for sequence output (writing files). This is a function taking three arguments: some SeqRecord objects, a handle to write to, and a sequence format.
Here is an example, where we start by creating a few SeqRecord objects the hard way (by hand, rather than by loading them from a file):
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.Alphabet import generic_protein
rec1 = SeqRecord(Seq("MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD" \
+"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK" \
+"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM" \
+"SSAC", generic_protein),
id="gi|14150838|gb|AAK54648.1|AF376133_1",
description="chalcone synthase [Cucumis sativus]")
rec2 = SeqRecord(Seq("YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ" \
+"DMVVVEIPKLGKEAAVKAIKEWGQ", generic_protein),
id="gi|13919613|gb|AAK33142.1|",
description="chalcone synthase [Fragaria vesca subsp. bracteata]")
rec3 = SeqRecord(Seq("MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC" \
+"EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP" \
+"KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN" \
+"NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV" \
+"SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW" \
+"IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT" \
+"TGEGLEWGVLFGFGPGLTVETVVLHSVAT", generic_protein),
id="gi|13925890|gb|AAK49457.1|",
description="chalcone synthase [Nicotiana tabacum]")
my_records = [rec1, rec2, rec3]
Now we have a list of SeqRecord objects, we’ll write them to a FASTA format file:
from Bio import SeqIO
handle = open("my_example.faa", "w")
SeqIO.write(my_records, handle, "fasta")
handle.close()
And if you open this file in your favourite text editor it should look like this:
>gi|14150838|gb|AAK54648.1|AF376133_1 chalcone synthase [Cucumis sativus] MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM SSAC >gi|13919613|gb|AAK33142.1| chalcone synthase [Fragaria vesca subsp. bracteata] YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ DMVVVEIPKLGKEAAVKAIKEWGQ >gi|13925890|gb|AAK49457.1| chalcone synthase [Nicotiana tabacum] MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT TGEGLEWGVLFGFGPGLTVETVVLHSVAT
In previous example we used a list of SeqRecord objects as input to the Bio.SeqIO.write() function, but it will also accept a SeqRecord interator like we get from Bio.SeqIO.parse() – this lets us do file conversion very succinctly. For this example we’ll read in the GenBank format file ls_orchid.gbk and write it out in FASTA format:
from Bio import SeqIO
in_handle = open("ls_orchid.gbk", "r")
out_handle = open("my_example.fasta", "w")
SeqIO.write(SeqIO.parse(in_handle, "genbank"), out_handle, "fasta")
in_handle.close()
out_handle.close()
You can in fact do this in one line, by being lazy about closing the file handles. This is arguably bad style, but it is very concise:
from Bio import SeqIO
SeqIO.write(SeqIO.parse(open("ls_orchid.gbk"), "genbank"), open("my_example.faa", "w"), "fasta")
Suppose you had a file of nucleotide sequences, and you wanted to turn it into a file containing their reverse complement sequences. This time a little bit of work is required to transform the SeqRecords we get from our input file into something suitable for saving to our output file.
To start with, we’ll use Bio.SeqIO.parse() to load some nucleotide
sequences from a file, then print out their reverse complements using
the Seq object’s built in .reverse_complement() method (see Section 3.5):
from Bio import SeqIO
in_handle = open("ls_orchid.gbk")
for record in SeqIO.parse(in_handle, "genbank") :
print record.id
print record.seq.reverse_complement().tostring()
in_handle.close()
Now, if we want to save these reverse complements to a file, we’ll need to make SeqRecord objects.
For this I think its most elegant to write our own function, where we can decide how to name our
new records:
from Bio.SeqRecord import SeqRecord
def make_rc_record(record) :
"""Returns a new SeqRecord with the reverse complement sequence"""
rc_rec = SeqRecord(seq = record.seq.reverse_complement(), \
id = "rc_" + record.id, \
name = "rc_" + record.name, \
description = "reverse complement")
return rc_rec
We can then use this to turn the input records into reverse complement records ready for output. If you don’t mind about having all the records in memory at once, then the python map() function is a very intuitive way of doing this:
from Bio import SeqIO
in_handle = open("ls_orchid.fasta", "r")
records = map(make_rc_record, SeqIO.parse(in_handle, "fasta"))
in_handle.close()
out_handle = open("rev_comp.fasta", "w")
SeqIO.write(records, out_handle, "fasta")
out_handle.close()
This is an excellent place to demonstrate the power of list comprehensions (added to Python 2.0) which in their simplest are a long-winded equivalent to using map(), like this:
records = [make_rc_record(rec) for rec in SeqIO.parse(in_handle, "fasta")]
Now list comprehensions have a nice trick up their sleaves, you can add a conditional statement:
records = [make_rc_record(rec) for rec in SeqIO.parse(in_handle, "fasta") if len(rec)<700]
That would create an in memory list of reverse complement records where the sequence length was under 700 base pairs. However, if you are using Python 2.4 or later, we can do exactly the same with a generator expression - but with the advantage that this does not create a list of all the records in memory at once:
records = (make_rc_record(rec) for rec in SeqIO.parse(in_handle, "fasta") if len(rec)<700)
If you like compact code, and don’t mind being lax about closing file handles, we can reduce this to one long line:
from Bio import SeqIO
SeqIO.write((make_rc_record(rec) for rec in \
SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") if len(rec) < 700), \
open("rev_comp.fasta", "w"), "fasta")
Personally, I think the above snippet of code is a little too compact, and I find the following much easier to read:
from Bio import SeqIO
records = (make_rc_record(rec) for rec in \
SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") \
if len(rec) < 700)
SeqIO.write(records, open("rev_comp.fasta", "w"), "fasta")
or, for Python 2.3 or older,
from Bio import SeqIO
records = [make_rc_record(rec) for rec in \
SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") \
if len(rec) < 700]
SeqIO.write(records, open("rev_comp.fasta", "w"), "fasta")